Over the course of 100 days in 1994, a meticulously orchestrated campaign of mass murder claimed the lives of roughly 800,000 Tutsis and moderate Hutus in Rwanda. This timeline reconstructs the sequence of events, from the disputed downing of the presidential aircraft to the systematic slaughter, the eventual military victory of the Rwandan Patriotic Front, and the long road to accountability.

On the evening of April 6, 1994, a Dassault Falcon 50 executive jet descended toward Kigali International Airport, carrying Rwandan President Juvénal Habyarimana and Burundian President Cyprien Ntaryamira [1.2]. The two leaders were returning from a regional summit in Dar es Salaam, Tanzania, where they had discussed the stalled Arusha Peace Accords. At approximately 8:20 p. m. local time, the aircraft was struck by surface-to-air missiles, erupting into flames and crashing into the grounds of the Rwandan presidential palace. All twelve people aboard, including the presidents, senior officials, and the French flight crew, perished instantly. The wreckage of the plane became ground zero for a meticulously planned campaign of extermination.

Within an hour of the crash, the streets of Kigali transformed into a labyrinth of lethal checkpoints. The Rwandan Presidential Guard, operating alongside the Interahamwe and Impuzamugambi militias, swiftly erected roadblocks across the capital. These forces immediately began hunting down prominent political opposition figures, moderate Hutus, and Tutsi civilians. The speed and coordination of this mobilization indicated that the extremist factions were already primed for violence, using the assassination as the immediate trigger to execute a pre-existing blueprint for mass murder.

Decades later, the identity of the assassins who fired the fatal missiles remains one of the most fiercely debated questions in modern African history. Early intelligence reports and subsequent investigations, including the 2010 Mutsinzi Report, pointed to Hutu military hardliners—specifically elements within the elite Presidential Guard stationed at the nearby Kanombe military camp. According to this theory, the extremists assassinated their own president to derail the power-sharing Arusha Accords and manufacture a pretext for ethnic cleansing. Conversely, a 2006 French judicial inquiry led by Judge Jean-Louis Bruguière accused the Rwandan Patriotic Front (RPF) rebels, commanded by Paul Kagame, of orchestrating the strike. Though later French ballistics experts cast doubt on Bruguière's findings by tracing the launch site to the government-controlled Kanombe camp, the geopolitical dispute over who lit the fuse of the genocide persists.

• On April 6, 1994, surface-to-air missiles shot down a jet carrying the presidents of Rwanda and Burundi over Kigali, killing all aboard [1.2].
• Within an hour, Hutu extremist militias and the Presidential Guard established roadblocks, initiating a systematic slaughter of Tutsis and moderate Hutus.
• The identity of the perpetrators remains contested, with investigations alternating blame between Hutu hardliners seeking a pretext for genocide and Rwandan Patriotic Front rebels.

**April 7, 1994 — The Purge Begins:** Within hours of the disputed missile strike that downed President Juvénal Habyarimana's aircraft [1.4], the Rwandan Armed Forces (FAR) and the Interahamwe militia seized control of Kigali's streets. Their immediate objective was a systematic purge of the political opposition. Death squads went door-to-door to hunt down moderate Hutu politicians and civil society leaders who posed a threat to the extremist agenda. This initial wave of violence was a highly organized decapitation strike designed to create an institutional vacuum and silence any voices advocating for the Arusha peace process.

**Morning of April 7 — The Assassination of the Prime Minister:** The highest-value target on the extremists' list was Prime Minister Agathe Uwilingiyimana, a moderate Hutu. Early that morning, ten Belgian peacekeepers serving under the United Nations Assistance Mission for Rwanda (UNAMIR) arrived at her residence. Their orders were to escort her to the national radio station to broadcast a desperate appeal for calm. Instead, Rwandan government soldiers surrounded the compound and outgunned the UN detail, forcing the peacekeepers to surrender their weapons. Shortly after, soldiers breached the property and brutally murdered Uwilingiyimana.

**Afternoon of April 7 to April 21 — The Camp Kigali Massacre and UN Withdrawal:** The captured Belgian soldiers were transported to a military camp in Kigali, where mutinous Rwandan troops brutally tortured and murdered all ten peacekeepers. International criminal tribunals later examined evidence indicating this massacre was a calculated strategy orchestrated by extremist leaders, including Colonel Théoneste Bagosora, to exploit Western political sensitivities and force a UN withdrawal. The grim tactic succeeded entirely. Following the slaughter of its soldiers, Brussels swiftly announced the withdrawal of its 450-strong contingent. By April 21, the UN Security Council voted to slash the remaining UNAMIR presence to a skeletal force of just 270 personnel. As foreign nationals were evacuated by heavily armed Western troops under Operation Amaryllis, the international community effectively locked the doors on its way out, leaving hundreds of thousands of civilians defenseless against the advancing death squads.

• Extremistmilitiassystematicallyassassinatedmoderate Hutupoliticianstocreateaninstitutionalvacuum[1.4].
• Prime Minister Agathe Uwilingiyimana was executed by Rwandan government soldiers at her home on the morning of April 7.
• Ten Belgian UNAMIR peacekeepers were disarmed, tortured, and murdered at a Kigali military camp in a deliberate strategy to force a Western military withdrawal.
• The UN Security Council responded to the Belgian troop withdrawal by reducing the UNAMIR force to 270 personnel, abandoning Rwandan civilians to the Interahamwe.

**Mid-April 1994: The Airwaves of Annihilation.** The violence that erupted in Kigali swiftly metastasized across Rwanda's rural provinces [1.8]. The extremist Hutu government weaponized the airwaves, utilizing Radio Télévision Libre des Mille Collines (RTLM) to broadcast relentless propaganda. Announcers read the names and addresses of Tutsis and moderate Hutus over the air, directing civilian militias—the Interahamwe—to their targets. Neighbors turned against neighbors as the broadcasts dehumanized the Tutsi minority, referring to them as "cockroaches". The sheer velocity of the killings reached an industrial scale, averaging an estimated 8,000 murders every single day.

**Late April to May 1994: Sexual Violence as a Weapon of War.** As the death toll climbed, the perpetrators deployed sexual violence as a calculated military tactic. Verified testimonies and subsequent international tribunal rulings confirm that between 250,000 and 500,000 women and girls were subjected to systematic rape, sexual mutilation, and forced captivity. Extremist militias explicitly sought to destroy the Tutsi population's reproductive capabilities. Perpetrators intentionally weaponized disease; hospital patients known to be infected with HIV were released and organized into "rape squads" to ensure a slow, agonizing death for survivors. This orchestrated campaign of sexual terror resulted in thousands of forced pregnancies and a devastating surge in HIV transmission rates.

**May to June 1994: Global Paralysis and the Debate Over "Genocide."** While the machinery of extermination operated at full capacity, the international community remained paralyzed by political calculation. Despite mounting, verified intelligence from UNAMIR Force Commander General Roméo Dallaire regarding the coordinated nature of the atrocities, the United Nations Security Council actively debated whether to classify the slaughter as a "genocide". Scarred by recent peacekeeping failures in Somalia, key member states resisted intervention and initially supported the withdrawal of the majority of UN peacekeepers. It was not until June 22 that the UN authorized a French-led military deployment, Operation Turquoise. By the time these forces arrived to establish a safe zone in the southwest, hundreds of thousands of civilians had already been hacked to death with machetes in the churches and schools where they had sought refuge.

• RTLMradiobroadcastsservedastheprimaryengineformobilizingcivilianmilitias, directlyincitingthemurderof Tutsisandmoderate Hutusatarateof8, 000deathsperday[1.3].
• Sexual violence was systematically weaponized, with up to 500,000 women raped and HIV intentionally transmitted by extremist "rape squads".
• The UN Security Council and major global powers failed to intervene during the critical months of April and May, deliberately avoiding the term "genocide" while withdrawing essential peacekeeping forces.

**July4, 1994: The Fallof Kigali.**Afterweeksofsteadyterritorialgains, the Rwandan Patriotic Front(RPF), commandedby Paul Kagame, seizedcontrolofthecapitalcityof Kigali[1.3]. This military victory effectively halted the 100-day extermination campaign that had systematically murdered an estimated 800,000 Tutsis and moderate Hutus. The defeated Rwandan Armed Forces and the Interahamwe militias retreated toward the western borders, using their remaining authority to drive the civilian population ahead of them as a buffer against the advancing rebel troops.

**Mid-July 1994: The Zaire Exodus and Humanitarian Collapse.** Driven by fear of reprisal and the ousted regime's radio propaganda, approximately two million Hutus poured into neighboring countries, primarily Zaire (now the Democratic Republic of the Congo). The sudden arrival of hundreds of thousands of people in border towns like Goma created an immediate, catastrophic public health emergency. The squalid, overcrowded camps—heavily militarized by fleeing genocidaires—lacked clean water and sanitation. By late July, explosive outbreaks of cholera and dysentery swept through the settlements, killing tens of thousands of refugees within weeks and overwhelming international relief agencies.

**July 19, 1994: Formation of the Transitional Government.** Seeking to stabilize a fractured state, the RPF established a Broad-Based Government of National Unity. The coalition was designed to project ethnic reconciliation, appointing Pasteur Bizimungu, an ethnic Hutu, as president. Paul Kagame assumed the roles of vice president and minister of defense, retaining ultimate military and political authority. The new administration faced the monumental task of governing a country where the infrastructure was destroyed, the treasury was empty, and the social fabric was entirely decimated.

**November 1994 and Beyond: The Long Pursuit of Justice.** The scale of the atrocities required a multi-tiered legal response. On November 8, 1994, the United Nations Security Council established the International Criminal Tribunal for Rwanda (ICTR) in Arusha, Tanzania, to prosecute the high-ranking architects of the slaughter. Because the conventional domestic legal system was paralyzed by the detention of over 120,000 lower-level suspects, the Rwandan government legally established the traditional, community-based Gacaca courts in 2001. Operating at the village level, these tribunals eventually processed more than a million cases, attempting to balance punitive accountability with the necessity of national reconciliation.

• The Rwandan Patriotic Front captured Kigali on July 4, 1994, ending a 100-day genocide that claimed roughly 800,000 lives.
• Nearly two million Hutus fled into neighboring Zaire and Tanzania, triggering a catastrophic cholera epidemic in the refugee camps.
• A transitional Government of National Unity was established on July 19, 1994, installing Pasteur Bizimungu as president and Paul Kagame as vice president.
• The UN established the International Criminal Tribunal for Rwanda in November 1994, while local Gacaca courts were later formed to try over a million lower-level suspects.